Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Contactin-3  

UniProtKB / Swiss-Prot ID :  CNTN3_HUMAN

Gene Name (Synonyms) : 
CNTN3, KIAA1496, PANG  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor (By similarity). 

Protein Function :  Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity (By similarity). 

Protein Sequence MMFPWKQLILLSFIGCLGGELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHYRWQLNGSDID...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCEEEEECCCCCCEEEEEEEECCCCCEEEEEECCEECC...
Protein Variant
LocationDescription
630S -> N (in dbSNP:rs626578). VAR_019906
708N -> S (in dbSNP:rs626578). VAR_056042
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
489N-linked (GlcNAc...).FGKANGTTH
CCCEEEEEE
52.40UniProtKB
Link-
860N-linked (GlcNAc...).KVAGNETSA
EECCCEEEE
39.37UniProtKB
Link
931N-linked (GlcNAc...).KAMENESEV
CCCCCCCEE
45.04UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry.";
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.;
J. Proteome Res. 4:2070-2080(2005).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-489; ASN-860 AND ASN-931,AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures