Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Contactin-6  

UniProtKB / Swiss-Prot ID :  CNTN6_MOUSE

Gene Name (Synonyms) : 
Cntn6  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor (By similarity). 

Protein Function :  Contactins mediate cell surface interactions during nervous system development. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus (By similarity). Involved in motor coordination. 

Protein Sequence MRLLWKLVILLPLINSCAGEGRFSRPIFIQEPQDVIFPLDLSRSEIILTCTANGYPSPHYRWKQNGTDID...
Predicted Secondary Structure CCHHHHHHHHHEEHHCCCCCCCCCCCEEEECCCCEEEEEEECCCCEEEEEEEECCCCCEEEEEECCEECC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures