Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Complement component C8 alpha chain  

UniProtKB / Swiss-Prot ID :  CO8A_HUMAN

Gene Name (Synonyms) : 
C8A  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. Cell membrane; Multi-pass membrane protein. Note=Secreted as soluble protein. Inserts into the cell membrane of target cells. 

Protein Function :  Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C8A inserts into the target membrane, but does not form pores by itself. 

Protein Sequence MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFG...
Predicted Secondary Structure CEEEEEEHHHHHHHCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant
LocationDescription
93Q -> K (in allele C8A*B; dbSNP:rs652785). VAR_011889
407T -> I (in dbSNP:rs706479). VAR_011890
458D -> N (in dbSNP:rs17114555). VAR_033800
485R -> L (in dbSNP:rs1620075). VAR_011891
561E -> Q (in dbSNP:rs1342440). VAR_011892
575P -> L (in dbSNP:rs17300936). VAR_033801
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
44C-linked (Man)QLSNWSEWT
CCCCCCCCC
8.34HPRD
Link-
44C-linked (Man)QLSNWSEWT
CCCCCCCCC
8.34OGlycBase
Link-
44C-linked (Man).QLSNWSEWT
CCCCCCCCC
8.34UniProtKB
Link-
290PhosphothreonineKFIFTRIFT
EEEEEEEEE
20.31HPRD
Link-
290PhosphothreonineKFIFTRIFT
EEEEEEEEE
20.31Phosphositeplus
Link-
341PhosphotyrosineYGTHYITSG
CCCEEEEEE
13.01Phosphositeplus
Link-
437N-linked (Glc...)GLAQNRSTI
HHHHCCCHH
33.97HPRD
Link-
437N-linked (GlcNAc...)GLAQNRSTI
HHHHCCCHH
33.97SysPTM
Link-
437N-linked (GlcNAc...).GLAQNRSTI
HHHHCCCHH
33.97UniProtKB
Link-
542C-linked (Man)ADGSWSCWS
CCCCCCCCC
11.75HPRD
Link-
542C-linked (Man)ADGSWSCWS
CCCCCCCCC
11.75OGlycBase
Link-
542C-linked (Man).ADGSWSCWS
CCCCCCCCC
11.75UniProtKB
Link-
545C-linked (Man)SWSCWSSWS
CCCCCCCCC
7.00HPRD
Link-
545C-linked (Man)SWSCWSSWS
CCCCCCCCC
7.00OGlycBase
Link-
545C-linked (Man).SWSCWSSWS
CCCCCCCCC
7.00UniProtKB
Link-
548C-linked (Man)CWSSWSVCR
CCCCCCCCC
6.83HPRD
Link-
548C-linked (Man)CWSSWSVCR
CCCCCCCCC
6.83OGlycBase
Link-
548C-linked (Man).CWSSWSVCR
CCCCCCCCC
6.83UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CD59_HUMANin vitroHPRD:00409HPRD7544344
CO8G_HUMANin vitroHPRD:00409HPRD11041874
CO9_HUMANin vitroHPRD:00409HPRD3624872
4063341
CO5_HUMANENSP00000354458STRING
CO5_HUMANENSP00000354458STRING
CO5_HUMANENSP00000354458STRING
CO8G_HUMANENSP00000354458STRING
CO9_HUMANENSP00000354458STRING
CO6_HUMANENSP00000354458STRING
CO7_HUMANENSP00000354458STRING
- top -

Disease Reference
Kegg disease
H00103 Late complement pathway defects, including the following seven diseases: C5 deficiency; C6 deficienc
OMIM disease
613790Complement component 8 deficiency, 1 (C8D1)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
C-linked Glycosylation
ReferencePubMed
"The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues.";
Hofsteenge J., Blommers M., Hess D., Furmanek A., Miroshnichenko O.;
J. Biol. Chem. 274:32786-32794(1999).
Cited for: GLYCOSYLATION AT TRP-44; TRP-542; TRP-545 AND TRP-548.
N-linked Glycosylation
ReferencePubMed
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry.";
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.;
J. Proteome Res. 4:2070-2080(2005).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-437, AND MASSSPECTROMETRY.
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-437, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures