Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Complement component C8 beta chain  

UniProtKB / Swiss-Prot ID :  CO8B_HUMAN

Gene Name (Synonyms) : 
C8B  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. 

Protein Function :  Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. 

Protein Sequence MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTLMPIDCELSSW...
Predicted Secondary Structure CCCCCEEEHHHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant
LocationDescription
108E -> K (in dbSNP:rs12067507). VAR_027649
117R -> G (in allotype C8B A;dbSNP:rs1013579).
261P -> L (in dbSNP:rs12085435). VAR_027650
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
70C-linked (Man)ELSSWSSWT
CCCCCCCCC
7.94HPRD
Link
70C-linked (Man)ELSSWSSWT
CCCCCCCCC
7.94OGlycBase
Link
70C-linked (Man).ELSSWSSWT
CCCCCCCCC
7.94UniProtKB
Link
73C-linked (Man)SWSSWTTCD
CCCCCCCCC
7.10HPRD
Link
73C-linked (Man)SWSSWTTCD
CCCCCCCCC
7.10OGlycBase
Link
73C-linked (Man).SWSSWTTCD
CCCCCCCCC
7.10UniProtKB
Link
144N-linked (Glc...)CNGDNDCGD
ECCCCCCCC
48.12HPRD
Link
243N-linked (GlcNAc...).DFERNVTEK
HHHHHHHHH
37.55UniProtKB
Link
346PhosphothreonineTHYITEAVL
CEEEEECCC
15.66Phosphositeplus
Link
371PhosphothreonineRGDYTLNNV
HCCCCHHHH
27.96Phosphositeplus
Link
418PhosphothreonineNKRDTMVED
HHHHHEEEE
27.44HPRD
Link
418PhosphothreonineNKRDTMVED
HHHHHEEEE
27.44SysPTM
Link
418Phosphothreonine.NKRDTMVED
HHHHHEEEE
27.44UniProtKB
Link
551C-linked (Man)KWNCWSNWS
CCCCCCCCC
7.47HPRD
Link
551C-linked (Man)KWNCWSNWS
CCCCCCCCC
7.47OGlycBase
Link
551C-linked (Man).KWNCWSNWS
CCCCCCCCC
7.47UniProtKB
Link
554C-linked (Man)CWSNWSSCS
CCCCCCCCC
6.01HPRD
Link
554C-linked (Man)CWSNWSSCS
CCCCCCCCC
6.01OGlycBase
Link
554C-linked (Man).CWSNWSSCS
CCCCCCCCC
6.01UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CO5_HUMANin vitroHPRD:00410HPRD3624872
CO8A_HUMANin vitro
in vivo
HPRD:00410HPRD10387094
CLUS_HUMANin vitroHPRD:00410HPRD8345200
- top -

Disease Reference
Kegg disease
OMIM disease
613789Complement component 8 deficiency, 2 (C8D2)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
C-linked Glycosylation
ReferencePubMed
"The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues.";
Hofsteenge J., Blommers M., Hess D., Furmanek A., Miroshnichenko O.;
J. Biol. Chem. 274:32786-32794(1999).
Cited for: GLYCOSYLATION AT TRP-70; TRP-73; TRP-551 AND TRP-554.
N-linked Glycosylation
ReferencePubMed
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry.";
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.;
J. Proteome Res. 4:2070-2080(2005).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-243, AND MASSSPECTROMETRY.
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-243, AND MASSSPECTROMETRY.
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteome profiling of Wnt3a-mediated signalingnetwork: indicating the involvement of ribonucleoside-diphosphatereductase M2 subunit phosphorylation at residue serine 20 in canonicalWnt signal transduction.";
Tang L.-Y., Deng N., Wang L.-S., Dai J., Wang Z.-L., Jiang X.-S.,Li S.-J., Li L., Sheng Q.-H., Wu D.-Q., Li L., Zeng R.;
Mol. Cell. Proteomics 6:1952-1967(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-418, AND MASSSPECTROMETRY.
"Structure of human C8 protein provides mechanistic insight intomembrane pore formation by complement.";
Lovelace L.L., Cooper C.L., Sodetz J.M., Lebioda L.;
J. Biol. Chem. 286:17585-17592(2011).
Cited for: X-RAY CRYSTALLOGRAPHY (2.51 ANGSTROMS) OF 55-591, PHOSPHORYLATION ATTHR-418, SUBUNIT, AND DISULFIDE BONDS.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures