Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cofilin-1  

UniProtKB / Swiss-Prot ID :  COF1_XENTR

Gene Name (Synonyms) : 
cfl1 TNeu055g03.1  

Species :  Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). 

Subcellular Localization :  Nucleus matrix (By similarity). Cytoplasm, cytoskeleton (By similarity). Cytoplasm, cell cortex (By similarity). Membrane (By similarity). Note=Cellular localization varies throughout development and may be related to phosphorylation levels. Shows diffus 

Protein Function :  May play a role in the regulation of cell morphology and cytoskeletal organization (By similarity). Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity. Required for formation of the cleavage furrow during cytokinesis. 

Protein Sequence MASGVMVSDDVIKVFNDMKVRHQLSPEEAKKRKKAVVFCLSEDKKMIILEPGKEILQGDVGCNVDDPYKA...
Predicted Secondary Structure CCCCCEECHHHHHHHHHHHHHCCCCHHHHCCCCCEEEEEECCCCEEEEEEECCCCCCCCCCCCCCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures