Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cytochrome c oxidase subunit 1  

UniProtKB / Swiss-Prot ID :  COX1_BOVIN

Gene Name (Synonyms) : 
MT-CO1, COI, COXI, MTCO1  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Mitochondrion inner membrane; Multi-pass membrane protein. 

Protein Function :  Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B. 

Transmembrane Topology (topPTM) : COX1_BOVIN 

Protein Sequence MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMV...
Predicted Secondary Structure CEEEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-formylmethionine.----MFINR
----CEEEE
7.40UniProtKB
Link
2401'-histidyl-3'-tyrosine (His-Tyr).WFFGHPEVY
HHHCCCEEE
15.36UniProtKB
Link
304PhosphotyrosineDTRAYFTSA
HHHHHHHHH
12.23Phosphositeplus
Link
441PhosphoserinePRRYSDYPD
CCCCCCCCH
28.93Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Formylation
ReferencePubMed
"Studies on cytochrome-c oxidase, XIV. The amino-acid sequence ofsubunit I -- proteinchemical methods for the analysis of a largehydrophobic membrane protein.";
Hensel S., Buse G.;
Biol. Chem. Hoppe-Seyler 371:411-422(1990).
Cited for: PROTEIN SEQUENCE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures