Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Carnitine O-palmitoyltransferase 1, liver isoform  

UniProtKB / Swiss-Prot ID :  CPT1A_HUMAN

Gene Name (Synonyms) : 
CPT1A, CPT1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion outer membrane; Multi-pass membrane protein. 

Protein Function :   

Transmembrane Topology (topPTM) : CPT1A_HUMAN 

Protein Sequence MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVM...
Predicted Secondary Structure CCCHHHHEEEEEEECCCCCEEEECHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHH...
Protein Variant
LocationDescription
123R -> C (in CPT1AD). VAR_020546
275A -> T (in dbSNP:rs2229738). VAR_020547
304C -> W (in CPT1AD). VAR_020548
314T -> I (in CPT1AD). VAR_020549
316R -> G (in CPT1AD). VAR_046767
343F -> V (in CPT1AD). VAR_046768
357R -> W (in CPT1AD; decreased stability). VAR_020550
360E -> G (in CPT1AD; reduced proteinlevels; dbSNP:rs28936372).
395Missing (in CPT1AD; loss of activity). VAR_020552
414A -> V (in CPT1AD; decreased activity;dbSNP:rs28936373).
454D -> G (in CPT1AD). VAR_020554
465G -> W (in CPT1AD). VAR_046769
479P -> L (in CPT1AD; decreased activity). VAR_020555
484L -> P (in CPT1AD). VAR_020556
498Y -> C (in CPT1AD; decreased activity). VAR_020557
709G -> E (in CPT1AD; loss of activity;dbSNP:rs28936374).
710G -> E (in CPT1AD; loss of activity). VAR_020559
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
86Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GIIAKINRT
HHHHHHHHH
30.06Phosphositeplus
Link-
161Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FSGRKPMLY
HCCCCCCCC
38.00Phosphositeplus
Link-
165PhosphotyrosineKPMLYSFQT
CCCCCCCCC
10.94Phosphositeplus
Link-
180Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VPAVKDTVN
CCCHHHHHH
50.19Phosphositeplus
Link-
195Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RPLMKEEDF
CCCCCHHHH
66.68Phosphositeplus
Link-
405Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RGKNKQSLD
CCCCHHHHH
44.76Phosphositeplus
Link-
514PhosphotyrosinePNIPYPTRL
CCCCCCCEE
17.28Phosphositeplus
Link-
675Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SPFLKEVLS
CCCCCHHHH
46.27Phosphositeplus
Link-
772Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SSNSKK
CCCCCC
67.75Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
BCL2_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:02755HPRD9070836
ACADL_HUMANENSP00000265641STRING
- top -

Disease Reference
Kegg disease
H00525 Disorders of fatty-acid oxidation, including: Medium-chain (MC) acyl-CoA dehydrogenase (AD) deficien
OMIM disease
255120Carnitine palmitoyltransferase 1A deficiency (CPT1AD)
Drug Reference
Kegg drug
D05292 Oxfenicine (USAN/INN)
D05442 Perhexiline maleate (USAN)
D08340 Perhexiline (INN)
DrugBank
DB01016Glyburide
DB00583L-Carnitine
DB01074Perhexiline
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures