Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Beta-crystallin B3  

UniProtKB / Swiss-Prot ID :  CRBB3_RAT

Gene Name (Synonyms) : 
Crybb3  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :   

Protein Function :  Crystallins are the dominant structural components of the vertebrate eye lens. 

Protein Sequence MAEQHGAPEQAAASKSHGGLGGSYKVTVYELENFQGKRCELSAECPNLTESLLQKVGSIQVESGPWLAFE...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCEEEECCCCEEEEE...
Protein Variant
LocationDescription
42S -> L.
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAEQHG
---CCCCCC
25.75UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lens proteomics: analysis of rat crystallin sequences and two-dimensional electrophoresis map.";
Lampi K.J., Shih M., Ueda Y., Shearer T.R., David L.L.;
Invest. Ophthalmol. Vis. Sci. 43:216-224(2002).
Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 2-211, ACETYLATION ATALA-2, MASS SPECTROMETRY, AND VARIANT LEU-42.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures