Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Uncharacterized protein C20orf4  

UniProtKB / Swiss-Prot ID :  CT004_HUMAN

Gene Name (Synonyms) : 
C20orf4 CGI-23, PRO0225  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAAVQMDPELAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKE...
Predicted Secondary Structure CCCCCCCHHHHHHHHHCCCEEEEECCCCCEEECCEEEECCCCCCCCCEECCCCCEEEEEEEECCCCCCCC...
Protein Variant
LocationDescription
124P -> T (in dbSNP:rs6121183). VAR_048127
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAVQM
---CCCCCC
19.15UniProtKB
Link-
12Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PELAKRLFF
HHHHHHHHH
63.36Phosphositeplus
Link-
44Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EVGPKFRGV
CCCCCCCCE
41.59Phosphositeplus
Link-
131Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YATLKKWIS
CCHHHHHHH
41.53Phosphositeplus
Link-
188PhosphotyrosineECKSYQEGL
CCCCCCCCH
8.97Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CXA5_HUMANphysical interactionMINT-67788MINT16189514
EAPP_HUMANphysical interactionEBI-756748
intact16189514
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures