Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cytochrome b5  

UniProtKB / Swiss-Prot ID :  CYB5_HUMAN

Gene Name (Synonyms) : 
CYB5A, CYB5  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Isoform 1: Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side. Isoform 2: Cytoplasm. 

Protein Function :  Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. 

Transmembrane Topology (topPTM) : CYB5_HUMAN 

Protein Sequence MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST...
Predicted Secondary Structure CCCCCCCCCEEECHHHHHHHCCCCCEEEEECCEEEECCCHHHHCCCCHHHHHHHCCCCCCHHHHHCCCCH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAEQSD
---CCCCCC
24.44UniProtKB
Link
10Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DEAVKYYTL
CCCCEEECH
39.32Phosphositeplus
Link
19N6-acetyllysineEEIQKHNHS
HHHHHHCCC
52.62HPRD
Link
39Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YDLTKFLEE
EECCCHHHH
56.07Phosphositeplus
Link
39N6-acetyllysineYDLTKFLEE
EECCCHHHH
56.07Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CP1A1_HUMANin vitroHPRD:08941HPRD6102994
CYC_HUMANin vitroHPRD:08941HPRD199233
9760250
NCPR_HUMANin vitroHPRD:08941HPRD9398194
CP17A_HUMANin vitroHPRD:08941HPRD9601054
ACOD_HUMANin vitroHPRD:08941HPRD6102994
NB5R3_HUMANENSP00000341625STRING
- top -

Disease Reference
Kegg disease
H00235 Methemoglobinemia
OMIM disease
250790Methemoglobinemia CYB5A-related (METHB-CYB5A)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures