Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cytochrome b5  

UniProtKB / Swiss-Prot ID :  CYB5_RAT

Gene Name (Synonyms) : 
Cyb5a, Cyb5  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single- pass membrane protein; Cytoplasmic side. 

Protein Function :  Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. It is also involved in several steps of the sterol biosynthesis pathway, particularly in the C-6 double bond introduction during the C-6 desaturation. 

Transmembrane Topology (topPTM) : CYB5_RAT 

Protein Sequence MAEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST...
Predicted Secondary Structure CCCCCCCCCCEECHHHHHHHCCCCCEEEEECCEEEECCCCHHHCCCCHHHHHHHCCCCCCHHHHHCCCCH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAEQSD
---CCCCCC
24.44UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Chemical structure of rat liver cytochrome b5. Isolation of peptidesby high-pressure liquid chromatography.";
Ozols J., Heinemann F.S.;
Biochim. Biophys. Acta 704:163-173(1982).
Cited for: PROTEIN SEQUENCE OF 2-134.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures