Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cytochrome c iso-1  

UniProtKB / Swiss-Prot ID :  CYC1_YEAST

Gene Name (Synonyms) : 
CYC1 YJR048W J1653  

Species :  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). 

Subcellular Localization :  Mitochondrion intermembrane space. Note=Loosely associated with the inner membrane (By similarity). 

Protein Function :  Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. 

Protein Sequence MTEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNM...
Predicted Secondary Structure CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
10Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AGSAKKGAT
CCCHHHHHH
54.13UbiProtDB
Link
78N6,N6,N6-trimethyllysineLTNPKKYIP
HHCCCCCCC
61.35MeMo
Link
78N6,N6,N6-trimethyllysine; by CTM1.LTNPKKYIP
HHCCCCCCC
61.35UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Methylation
ReferencePubMed
"Cytochrome c methyltransferase, Ctm1p, of yeast.";
Polevoda B., Martzen M.R., Das B., Phizicky E.M., Sherman F.;
J. Biol. Chem. 275:20508-20513(2000).
Cited for: METHYLATION AT LYS-78, AND MUTAGENESIS OF LYS-78.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures