Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cytochrome c  

UniProtKB / Swiss-Prot ID :  CYC_HORSE

Gene Name (Synonyms) : 
CYCS, CYC  

Species :  Equus caballus (Horse). 

Subcellular Localization :  Mitochondrion intermembrane space. Note=Loosely associated with the inner membrane. 

Protein Function :  Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. Plays a role in apoptosis. Suppression of the anti- apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases (By similarity). 

Protein Sequence MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWKEETLMEYLE...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylglycine.---MGDVEK
---CCCHHH
47.90UniProtKB
Link
9N6-acetyllysineEKGKKIFVQ
HHHHHHHHH
50.47Phosphositeplus
Link
28N6-acetyllysineGGKHKTGPN
CCCCCCCCC
59.67Phosphositeplus
Link
73N6-acetyllysineLENPKKYIP
HHCCCCCCC
70.55Phosphositeplus
Link
87N6-acetyllysineFAGIKKKTE
CCCCCCHHH
47.50Phosphositeplus
Link
88N6-acetyllysineAGIKKKTER
CCCCCHHHH
64.11Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Amino-acid sequence of horse heart cytochrome c.";
Margoliash E., Smith E.L., Kreil G., Tuppy H.;
Nature 192:1125-1127(1961).
Cited for: PROTEIN SEQUENCE OF 2-105, AND ACETYLATION AT GLY-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures