Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cytochrome c  

UniProtKB / Swiss-Prot ID :  CYC_HUMAN

Gene Name (Synonyms) : 
CYCS, CYC  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion intermembrane space. Note=Loosely associated with the inner membrane. 

Protein Function :  Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. Plays a role in apoptosis. Suppression of the anti- apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases. 

Protein Sequence MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLE...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHHHH...
Protein Variant
LocationDescription
42G -> S (in THC4; increases the pro-apoptotic function by triggering caspase
56K -> R (in dbSNP:rs11548795). VAR_048850
66M -> L (in 10% of the molecules). VAR_002204
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylglycine.---MGDVEK
---CCCHHH
47.90UniProtKB
Link
29PhosphothreonineGKHKTGPNL
CCCCCCCCC
58.55HPRD
Link
29PhosphothreonineGKHKTGPNL
CCCCCCCCC
58.55Phosphositeplus
Link
40Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LFGRKTGQA
CCCCCCCCC
58.34Phosphositeplus
Link
49PhosphotyrosinePGYSYTAAN
CCCCCCHHH
7.60Phosphositeplus
Link
54Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TAANKNKGI
CHHHHCCCC
56.14Phosphositeplus
Link
80Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IPGTKMIFV
CCCCCCCCC
35.59Phosphositeplus
Link
87Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FVGIKKKEE
CCCCCCHHH
52.44Phosphositeplus
Link
88N6-acetyllysineVGIKKKEER
CCCCCHHHH
64.59Phosphositeplus
Link
89N6-acetyllysineGIKKKEERA
CCCCHHHHH
60.86Phosphositeplus
Link
98PhosphotyrosineDLIAYLKKA
HHHHHHHHH
16.44Phosphositeplus
Link
100Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IAYLKKATN
HHHHHHHCC
27.90Phosphositeplus
Link
100N6-acetyllysineIAYLKKATN
HHHHHHHCC
27.90HPRD
Link
100N6-acetyllysineIAYLKKATN
HHHHHHHCC
27.90Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ADX_HUMANin vivoHPRD:00479HPRD6270113
QCR1_HUMANENSP00000307786STRING
QCR1_HUMANENSP00000307786STRING
HSP7C_HUMANENSP00000307786STRING
HSP7C_HUMANENSP00000307786STRING
CX6A1_HUMANENSP00000307786STRING
CX6A1_HUMANENSP00000307786STRING
COX7R_HUMANENSP00000307786STRING
COX7R_HUMANENSP00000307786STRING
C8AP2_HUMANENSP00000307786STRING
C8AP2_HUMANENSP00000307786STRING
CX6B1_HUMANENSP00000307786STRING
CX6B1_HUMANENSP00000307786STRING
COX7C_HUMANENSP00000307786STRING
COX7C_HUMANENSP00000307786STRING
HSPB1_HUMANENSP00000307786STRING
HSPB1_HUMANENSP00000307786STRING
SCO2_HUMANENSP00000307786STRING
SCO2_HUMANENSP00000307786STRING
COX41_HUMANENSP00000307786STRING
COX41_HUMANENSP00000307786STRING
COX5B_HUMANENSP00000307786STRING
COX5B_HUMANENSP00000307786STRING
CASP1_HUMANENSP00000307786STRING
CASP1_HUMANENSP00000307786STRING
COX10_HUMANENSP00000307786STRING
COX10_HUMANENSP00000307786STRING
QCR10_HUMANENSP00000307786STRING
QCR10_HUMANENSP00000307786STRING
VDAC1_HUMANENSP00000307786STRING
VDAC1_HUMANENSP00000307786STRING
QCR2_HUMANENSP00000307786STRING
QCR2_HUMANENSP00000307786STRING
P53_HUMANENSP00000307786STRING
P53_HUMANENSP00000307786STRING
QCR7_HUMANENSP00000307786STRING
QCR7_HUMANENSP00000307786STRING
AIFM1_HUMANENSP00000307786STRING
AIFM1_HUMANENSP00000307786STRING
BAX_HUMANENSP00000307786STRING
BAX_HUMANENSP00000307786STRING
CYAC3_HUMANENSP00000307786STRING
CYAC3_HUMANENSP00000307786STRING
CYAC3_HUMANENSP00000307786STRING
CYAC3_HUMANENSP00000307786STRING
COX6C_HUMANENSP00000307786STRING
COX6C_HUMANENSP00000307786STRING
CASP7_HUMANENSP00000307786STRING
CASP7_HUMANENSP00000307786STRING
BCLX_HUMANENSP00000307786STRING
BCLX_HUMANENSP00000307786STRING
UCRI_HUMANENSP00000307786STRING
UCRI_HUMANENSP00000307786STRING
BAD_HUMANENSP00000307786STRING
BAD_HUMANENSP00000307786STRING
QCR6_HUMANENSP00000307786STRING
QCR6_HUMANENSP00000307786STRING
PEO1_HUMANENSP00000307786STRING
PEO1_HUMANENSP00000307786STRING
CASP3_HUMANENSP00000307786STRING
CASP3_HUMANENSP00000307786STRING
CY1_HUMANENSP00000307786STRING
CY1_HUMANENSP00000307786STRING
COX5A_HUMANENSP00000307786STRING
COX5A_HUMANENSP00000307786STRING
BID_HUMANENSP00000307786STRING
BID_HUMANENSP00000307786STRING
COX82_HUMANENSP00000307786STRING
COX82_HUMANENSP00000307786STRING
CASP9_HUMANENSP00000307786STRING
CASP9_HUMANENSP00000307786STRING
TNR6_HUMANENSP00000307786STRING
TNR6_HUMANENSP00000307786STRING
BIM_HUMANENSP00000307786STRING
BIM_HUMANENSP00000307786STRING
CASP8_HUMANENSP00000307786STRING
CASP8_HUMANENSP00000307786STRING
APAF_HUMANENSP00000307786STRING
APAF_HUMANENSP00000307786STRING
COX1_HUMANENSP00000307786STRING
COX1_HUMANENSP00000307786STRING
CYB_HUMANENSP00000307786STRING
CYB_HUMANENSP00000307786STRING
COX2_HUMANENSP00000307786STRING
COX2_HUMANENSP00000307786STRING
COX3_HUMANENSP00000307786STRING
COX3_HUMANENSP00000307786STRING
- top -

Disease Reference
Kegg disease
OMIM disease
612004Thrombocytopenia 4 (THC4)
Drug Reference
DrugBank
DB01017Minocycline
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"The amino acid sequence of human heart cytochrome c.";
Matsubara H., Smith E.L.;
J. Biol. Chem. 237:3575-3576(1962).
Cited for: PROTEIN SEQUENCE OF 2-105, AND ACETYLATION AT GLY-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures