Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cytochrome c  

UniProtKB / Swiss-Prot ID :  CYC_SOLTU

Gene Name (Synonyms) :  -
 

Species :  Solanum tuberosum (Potato). 

Subcellular Localization :  Mitochondrion intermembrane space. Note=Loosely associated with the inner membrane. 

Protein Function :  Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. 

Protein Sequence ASFGEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKEGPNLNGLFGRQSGTTAGYSYSNANKNMAVTWGEN...
Predicted Secondary Structure CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCHH...
Protein Variant
LocationDescription
98E -> D.
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylalanine.----ASFGE
----CCCCC
25.52UniProtKB
Link-
80N6,N6,N6-trimethyllysine.LLNPKKYIP
HHCCCCCCC
58.07UniProtKB
Link-
94N6,N6,N6-trimethyllysine.FPGLKKPQE
CCCCCCHHH
69.21UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"The amino acid sequence of cytochrome c from Solanum tuberosum(potato).";
Martinez G., Rochat H., Ducet G.;
FEBS Lett. 47:212-217(1974).
Cited for: PROTEIN SEQUENCE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures