Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Protein CysO  

UniProtKB / Swiss-Prot ID :  CYSO_AERPE

Gene Name (Synonyms) : 
cysO APE_1586  

Species :  Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC100138 / K1). 

Subcellular Localization :   

Protein Function :  Cysteine synthase that can also catalyze the synthesis of S-sulfo-L-cysteine from thiosulfate and O(3)-acetyl-L-serine, as well as the sulfhydrylation of L-serine by sulfide. 

Protein Sequence MALADISGYLDVLDSVRGFSYLENAREVLRSGEARCLGNPRSEPEYVKALYVIGASRIPVGDGCSHTLEE...
Predicted Secondary Structure CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHCCCHHHCCCCCCHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
127N6-(pyridoxal phosphate)lysine.SLSVKDRPA
CCCHHHHHH
44.64UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures