Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Protein dpy-19 homolog 4  

UniProtKB / Swiss-Prot ID :  D19L4_HUMAN

Gene Name (Synonyms) : 
DPY19L4  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Membrane; Multi-pass membrane protein (Potential). 

Protein Function :   

Transmembrane Topology (topPTM) : D19L4_HUMAN 

Protein Sequence MAEEEGPPVELRQRKKPKSSENKESAKEEKISDIPIPERAPKHVLFQRFAKIFIGCLAAVTSGMMYALYL...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
108Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KDMLKAPSF
52.17Phosphositeplus
Link-
450Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GKSLKETVT
59.43Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures