Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Complement decay-accelerating factor  

UniProtKB / Swiss-Prot ID :  DAF_HUMAN

Gene Name (Synonyms) : 
CD55, CR, DAF  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2: Cell membrane; Lipid-anchor, GPI- anchor. 

Protein Function :  This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. 

Protein Sequence MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFV...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCHHHHHHHHHHHHEEECCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEECCCCE...
Protein Variant
LocationDescription
52R -> L (in Tc(b) antigen;dbSNP:rs28371588).
52R -> P (in Tc(c) antigen). VAR_001998
82L -> R (in WES(a) antigen). VAR_001999
199S -> L (in Dr(a-) antigen;dbSNP:rs56283594).
227A -> P (in Cr(a-) antigen;dbSNP:rs60822373).
240R -> H (in GUTI(-) antigen). VAR_015884
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
95N-linked (Glc...)EEFCNRSCE
CCEEEECCC
44.19HPRD
Link-
95N-linked (GlcNAc...)EEFCNRSCE
CCEEEECCC
44.19SysPTM
Link-
95N-linked (GlcNAc...).EEFCNRSCE
CCEEEECCC
44.19UniProtKB
Link-
140PhosphoserineEPSLSPKLT
CCCCCEEEE
25.07HPRD
Link-
140PhosphoserineEPSLSPKLT
CCCCCEEEE
25.07Phosphositeplus
Link-
140Phosphoserine.EPSLSPKLT
CCCCCEEEE
25.07UniProtKB
Link-
353GPI-anchor amidated serineSGTTSGTTR
CCCCCCCCE
33.70HPRD
Link-
353GPI-anchor amidated serine.SGTTSGTTR
CCCCCCCCE
33.70UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CR1_HUMANin vitroHPRD:00500HPRD11694537
DAF_HUMANin vitroHPRD:00500HPRD12499389
- top -

Disease Reference
Kegg disease
H00106 Complement regulatory protein defects, including the following six diseases: C1 inhibitor deficiency
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
GPI-anchor
ReferencePubMed
"Glycophospholipid membrane anchor attachment. Molecular analysis ofthe cleavage/attachment site.";
Moran P., Raab H., Kohr W.J., Caras I.W.;
J. Biol. Chem. 266:1250-1257(1991).
Cited for: GPI-ANCHOR AT SER-353.
"Proteomic analysis of glycosylphosphatidylinositol-anchored membraneproteins.";
Elortza F., Nuehse T.S., Foster L.J., Stensballe A., Peck S.C.,Jensen O.N.;
Mol. Cell. Proteomics 2:1261-1270(2003).
Cited for: GPI-ANCHOR [LARGE SCALE ANALYSIS], AND MASS SPECTROMETRY.
"Modification-specific proteomics of plasma membrane proteins:identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment.";
Elortza F., Mohammed S., Bunkenborg J., Foster L.J., Nuehse T.S.,Brodbeck U., Peck S.C., Jensen O.N.;
J. Proteome Res. 5:935-943(2006).
Cited for: GPI-ANCHOR [LARGE SCALE ANALYSIS], AND MASS SPECTROMETRY.
N-linked Glycosylation
ReferencePubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-95, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.";
Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.;
J. Proteome Res. 6:4150-4162(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures