Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide  

UniProtKB / Swiss-Prot ID :  DAPP1_HUMAN

Gene Name (Synonyms) : 
DAPP1, BAM32 HSPC066  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Membrane; Peripheral membrane protein. Note=Membrane-associated after cell stimulation leading to its translocation. 

Protein Function :  May act as a B-cell-associated adapter that regulates B- cell antigen receptor (BCR)-signaling downstream of PI3K. 

Protein Sequence MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLY...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHCCCCCCCEEEECCCCCCCCE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
139PhosphotyrosineEPSIYESVR
CCCCCCCCC
13.39HPRD
Link-
139PhosphotyrosineEPSIYESVR
CCCCCCCCC
13.39Phosphositeplus
Link-
139PhosphotyrosineEPSIYESVR
CCCCCCCCC
13.39SysPTM
Link-
139Phosphotyrosine (BTK)EPSIYESVR
CCCCCCCCC
13.39HPRD
Link-
139Phosphotyrosine (LCK)EPSIYESVR
CCCCCCCCC
13.39HPRD
Link-
139Phosphotyrosine (Lck)EPSIYESVR
CCCCCCCCC
13.39PhosphoELM
Link-
139Phosphotyrosine (LYN)EPSIYESVR
CCCCCCCCC
13.39HPRD
Link-
139Phosphotyrosine (SRC)EPSIYESVR
CCCCCCCCC
13.39HPRD
Link-
139Phosphotyrosine.EPSIYESVR
CCCCCCCCC
13.39UniProtKB
Link-
182N6-acetyllysineVKTWKTRWF
CCCCCEEEE
33.18Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ERBB3_HUMANphysical interactionMINT-74510MINT16273093
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-139, AND MASSSPECTROMETRY.
"Multiple reaction monitoring for robust quantitative proteomicanalysis of cellular signaling networks.";
Wolf-Yadlin A., Hautaniemi S., Lauffenburger D.A., White F.M.;
Proc. Natl. Acad. Sci. U.S.A. 104:5860-5865(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-139, AND MASSSPECTROMETRY.
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells.";
Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.;
J. Proteome Res. 8:3852-3861(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-139, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures