Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glutamate decarboxylase 2  

UniProtKB / Swiss-Prot ID :  DCE2_HUMAN

Gene Name (Synonyms) : 
GAD2, GAD65  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm, cytosol. Cytoplasmic vesicle. Cell junction, synapse, presynaptic cell membrane; Lipid-anchor. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Note=Associated to cytoplasmic vesicles. In neurons, cytosolic leaflet of G 

Protein Function :  Catalyzes the production of GABA. 

Protein Sequence MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGGSQPPRAAARK...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHCCCCCCHHHHHH...
Protein Variant
LocationDescription
12G -> R (in dbSNP:rs8190591). VAR_018821
124K -> N (in dbSNP:rs8190600). VAR_018822
153P -> Q (in dbSNP:rs2839672). VAR_029176
232G -> E (in dbSNP:rs2839673). VAR_029177
286K -> R (in dbSNP:rs8190671). VAR_018823
326G -> A (in dbSNP:rs2839678). VAR_029178
375R -> Q (in dbSNP:rs8190730). VAR_018824
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
3Phosphoserine--MASPGSG
--CCCCCCC
28.61Phosphositeplus
Link-
3Phosphoserine.--MASPGSG
--CCCCCCC
28.61UniProtKB
Link-
6PhosphoserineASPGSGFWS
CCCCCCCCC
33.91Phosphositeplus
Link-
6Phosphoserine.ASPGSGFWS
CCCCCCCCC
33.91UniProtKB
Link-
10PhosphoserineSGFWSFGSE
CCCCCCCCC
19.91Phosphositeplus
Link-
10Phosphoserine.SGFWSFGSE
CCCCCCCCC
19.91UniProtKB
Link-
13PhosphoserineWSFGSEDGS
CCCCCCCCC
30.42Phosphositeplus
Link-
13Phosphoserine.WSFGSEDGS
CCCCCCCCC
30.42UniProtKB
Link-
30S-palmitoyl cysteine.ARAWCQVAQ
HHHHHHHHH
1.97UniProtKB
Link-
45S-palmitoyl cysteine.GNKLCALLY
HHHHHHHHH
2.40UniProtKB
Link-
69noneRAAARKAAC
HHHHHHHHH
25.15HPRD
Link-
396N6-(pyridoxal phosphate)lysine.WNPHKMMGV
ECCHHHCCC
31.66UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
DCE2_HUMANdirect interactionDIP:57366EDIP17384644
KPCE_HUMANin vitroHPRD:11817HPRD15147202
GSH1_HUMANENSP00000259271STRING
AATM_HUMANENSP00000259271STRING
AATM_HUMANENSP00000259271STRING
CDO1_HUMANENSP00000259271STRING
INS_HUMANENSP00000259271STRING
INS_HUMANENSP00000259271STRING
ASSY_HUMANENSP00000259271STRING
ACY3_HUMANENSP00000259271STRING
BAAT_HUMANENSP00000259271STRING
ACY2_HUMANENSP00000259271STRING
SYDC_HUMANENSP00000259271STRING
PYR1_HUMANENSP00000259271STRING
GABT_HUMANENSP00000259271STRING
DHE3_HUMANENSP00000259271STRING
GLSL_HUMANENSP00000259271STRING
GLSK_HUMANENSP00000259271STRING
BUP1_HUMANENSP00000259271STRING
DHE4_HUMANENSP00000259271STRING
GGT5_HUMANENSP00000259271STRING
ZDH17_HUMANENSP00000259271STRING
GGT4_HUMANENSP00000259271STRING
SYEM_HUMANENSP00000259271STRING
GLNA_HUMANENSP00000259271STRING
ALAT2_HUMANENSP00000259271STRING
DCE1_HUMANENSP00000259271STRING
CNDP1_HUMANENSP00000259271STRING
SYDM_HUMANENSP00000259271STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Palmitoylation
ReferencePubMed
"A combination of three distinct trafficking signals mediates axonaltargeting and presynaptic clustering of GAD65.";
Kanaani J., El-Din El-Husseini A., Aguilera-Moreno A., Diacovo J.M.,Bredt D.S., Baekkeskov S.;
J. Cell Biol. 158:1229-1238(2002).
Cited for: SUBCELLULAR LOCATION, AND PALMITOYLATION AT CYS-30 AND CYS-45.
Phosphorylation
ReferencePubMed
"Phosphorylation of serine residues 3, 6, 10, and 13 distinguishesmembrane anchored from soluble glutamic acid decarboxylase 65 and isrestricted to glutamic acid decarboxylase 65alpha.";
Namchuk M., Lindsay L., Turck C.W., Kanaani J., Baekkeskov S.;
J. Biol. Chem. 272:1548-1557(1997).
Cited for: PHOSPHORYLATION AT SER-3; SER-6; SER-10 AND SER-13, ANDBIOPHYSICOCHEMICAL PROPERTIES.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures