Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ornithine decarboxylase  

UniProtKB / Swiss-Prot ID :  DCOR_HUMAN

Gene Name (Synonyms) : 
ODC1  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC...
Predicted Secondary Structure CCCCCCCCEEEEEEECCCCHHHHHHHHHCCCCCCCCCCCEEEECHHHHHHHHHHHHHHCCCCCEEEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
27Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ILDQKINEV
HHHHHHCCC
47.36Phosphositeplus
Link
50Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GDILKKHLR
HHHHHHHHH
38.18Phosphositeplus
Link
69N6-(pyridoxal phosphate)lysine.FYAVKCNDS
EEEEEECCC
21.10UniProtKB
Link
247Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DVKLKFEEI
CCCCCHHHH
45.04Phosphositeplus
Link
261Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PALDKYFPS
HHHHHHCCC
50.03Phosphositeplus
Link
360S-nitrosocysteineWGPTCDGLD
ECCEECCCC
4.38dbSNO
Link
360S-nitrosocysteineWGPTCDGLD
ECCEECCCC
4.38HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
SMAD3_HUMANphysical interactionMINT-51238MINT15527767
DCOR_HUMANin vitroHPRD:01324HPRD10623504
OTC_HUMANENSP00000234111STRING
ACY1_HUMANENSP00000234111STRING
AOC2_HUMANENSP00000234111STRING
ARGI2_HUMANENSP00000234111STRING
SAT2_HUMANENSP00000234111STRING
AOC3_HUMANENSP00000234111STRING
ABP1_HUMANENSP00000234111STRING
- top -

Disease Reference
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00127Spermine
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures