Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  N(G),N(G)-dimethylarginine dimethylaminohydrolase 1  

UniProtKB / Swiss-Prot ID :  DDAH1_RAT

Gene Name (Synonyms) : 
Ddah1, Ddah  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :   

Protein Function :  Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation. 

Protein Sequence MAGLSHPSVFGRATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHQLYVGVLGSKLGLQVVQLPADES...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGLSH
---CCCCCC
27.86UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Cloning and sequencing of cDNA encoding NG,NG-dimethylargininedimethylaminohydrolase from rat kidney.";
Kimoto M., Sasakawa T., Tsuji H., Miyatake S., Oka T., Nio N.,Ogawa T.;
Biochim. Biophys. Acta 1337:6-10(1997).
Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE, AND ACETYLATIONAT ALA-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures