Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Aromatic-L-amino-acid decarboxylase  

UniProtKB / Swiss-Prot ID :  DDC_HUMAN

Gene Name (Synonyms) : 
DDC, AADC  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Catalyzes the decarboxylation of L-3,4- dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. 

Protein Sequence MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTH...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHC...
Protein Variant
LocationDescription
17M -> V (in dbSNP:rs6264). VAR_014788
47P -> H (in AADCD). VAR_046137
61E -> D (in dbSNP:rs11575292). VAR_019214
91A -> V (in AADCD). VAR_046138
102G -> S (in AADCD). VAR_019309
147S -> R (in AADCD). VAR_046139
210P -> L (in dbSNP:rs6262). VAR_014789
217M -> V (in dbSNP:rs6263). VAR_014790
239M -> I (in dbSNP:rs11575377). VAR_019215
239M -> L (in dbSNP:rs11575376). VAR_019216
250S -> F (in AADCD). VAR_046140
275A -> T (in AADCD). VAR_046141
309F -> L (in AADCD). VAR_046142
347R -> Q (in AADCD). VAR_046143
408L -> I (in AADCD). VAR_046144
462R -> Q (in dbSNP:rs11575542). VAR_019217
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
303N6-(pyridoxal phosphate)lysine.FNPHKWLLV
ECCHHHCCC
40.57UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ANDR_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:00145HPRD12864730
- top -

Disease Reference
Kegg disease
OMIM disease
608643Aromatic L-amino-acid decarboxylase deficiency (AADCD)
Drug Reference
DrugBank
DB00915Amantadine
DB00190Carbidopa
DB00260Cycloserine
DB06262Droxidopa
DB00875Flupentixol
DB01235L-DOPA
DB00150L-Tryptophan
DB00968Methyldopa
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures