Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Density-regulated protein  

UniProtKB / Swiss-Prot ID :  DENR_MOUSE

Gene Name (Synonyms) : 
Denr  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :  May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon (By similarity). 

Protein Sequence MATDISESSGADCKGDTKNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTV...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHCCCCHHHHHHHHHCCCHHHHHHCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
69PhosphothreonineFAKLTVENS
HHHCCCCCC
25.68Phosphositeplus
Link-
73PhosphoserineTVENSPKQE
CCCCCCHHH
21.70Phosphositeplus
Link-
81PhosphothreonineETGITEGQG
HHCCCCCCC
35.09Phosphositeplus
Link-
189PhosphoserineVDDDSIEDL
CCHHHHHHH
34.57Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures