Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Destrin  

UniProtKB / Swiss-Prot ID :  DEST_MOUSE

Gene Name (Synonyms) : 
Dstn, Dsn, Sid23  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :  Actin-depolymerizing protein. Severs actin filaments (F- actin) and binds to actin monomers (G-actin). Acts in a pH- independent manner. 

Protein Sequence MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIVVEEGKEILVGDVGATITDPFKH...
Predicted Secondary Structure CCCCCEECHHHHHHHHHHHHHHCCCHHHHCCCCEEEEEEECCCCEEEEEEECCCEEECCCCCCCCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
3Phosphoserine--MASGVQV
--CCCCCEE
37.89Phosphositeplus
Link-
3Phosphoserine.--MASGVQV
--CCCCCEE
37.89UniProtKB
Link-
23S-nitrosocysteineKVRKCSTPE
HHHHCCCHH
3.72dbSNO
Link-
24PhosphoserineVRKCSTPEE
HHHCCCHHH
50.46Phosphositeplus
Link-
25PhosphothreonineRKCSTPEEI
HHCCCHHHH
44.16Phosphositeplus
Link-
39S-nitrosocysteineAVIFCLSAD
EEEEEECCC
1.70dbSNO
Link-
80S-nitrosocysteinePEKDCRYAL
CCCCCEEEE
5.47dbSNO
Link-
117PhosphotyrosineSKMIYASSK
HHHHHHHHH
9.27Phosphositeplus
Link-
147S-nitrosocysteineLNRTCIAEK
CCHHHHHHH
2.21dbSNO
Link-
163PhosphoserineAFEGSPV
EEECCCC
18.45Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry.";
Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.;
J. Proteome Res. 7:5314-5326(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3, AND MASSSPECTROMETRY.
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry.";
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.;
Mol. Cell. Proteomics 8:904-912(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures