Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Destrin  

UniProtKB / Swiss-Prot ID :  DEST_RAT

Gene Name (Synonyms) : 
Dstn  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :   

Protein Function :  Actin-depolymerizing protein, AND MASS SPECTROMETRY. Severs actin filaments (F-actin) and binds to actin monomers (G- actin). Acts in a pH-independent manner. 

Protein Sequence MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIVVEEGKEILVGDVGVTITDPFKH...
Predicted Secondary Structure CCCCCEECHHHHHHHHHHHHHHCCCHHHHCCCCCEEEEEECCCCEEEEEEECCCCCCCCCCCCCCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASGVQ
---CCCCCE
18.26UniProtKB
Link-
3Phosphoserine--MASGVQV
--CCCCCEE
37.89Phosphositeplus
Link-
3Phosphoserine.--MASGVQV
--CCCCCEE
37.89UniProtKB
Link-
147PhosphoserineLNRTSIAEK
CCHHHHHHH
19.30Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Complete amino acid sequences and phosphorylation sites, determinedby Edman degradation and mass spectrometry, of rat parotid destrin-and cofilin-like proteins.";
Kanamori T., Suzuki M., Titani K.;
Arch. Oral Biol. 43:955-967(1998).
Cited for: PROTEIN SEQUENCE OF 2-165, ACETYLATION AT ALA-2, PHOSPHORYLATION ATSER-3, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Complete amino acid sequences and phosphorylation sites, determinedby Edman degradation and mass spectrometry, of rat parotid destrin-and cofilin-like proteins.";
Kanamori T., Suzuki M., Titani K.;
Arch. Oral Biol. 43:955-967(1998).
Cited for: PROTEIN SEQUENCE OF 2-165, ACETYLATION AT ALA-2, PHOSPHORYLATION ATSER-3, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures