Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Corticosteroid 11-beta-dehydrogenase isozyme 1  

UniProtKB / Swiss-Prot ID :  DHI1_HUMAN

Gene Name (Synonyms) : 
HSD11B1, HSD11, HSD11L  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Endoplasmic reticulum membrane; Single-pass type II membrane protein. 

Protein Function :  Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7- ketocholesterol to 7-beta-hydroxycholesterol (By similarity). 

Transmembrane Topology (topPTM) : DHI1_HUMAN 

Protein Sequence MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKET...
Predicted Secondary Structure CHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHH...
Protein Variant
LocationDescription
148V -> E (in a breast cancer sample;somatic mutation).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
123N-linked (GlcNAc...).NHITNTSLN
CCCCCCCCC
27.37UniProtKB
Link
162N-linked (GlcNAc...).LKQSNGSIV
HHCCCCEEE
45.82UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
3BHS1_HUMANENSP00000261465STRING
AK1D1_HUMANENSP00000261465STRING
AK1C4_HUMANENSP00000261465STRING
C11B1_HUMANENSP00000261465STRING
DHI2_HUMANENSP00000261465STRING
C11B2_HUMANENSP00000261465STRING
- top -

Disease Reference
Kegg disease
H01111 Cortisone reductase deficiency (CRD)
OMIM disease
604931Cortisone reductase deficiency (CRD)
Drug Reference
Kegg drug
D00156 Glycyrrhetinic acid (JAN); Enoxolone (INN); Hidermart (TN)
D01899 Carbenoxolone sodium (JAN/USAN)
D07615 Carbenoxolone (INN)
DrugBank
DB00635Prednisone
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-123 AND ASN-162, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures