Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Homoserine dehydrogenase  

UniProtKB / Swiss-Prot ID :  DHOM_YEAST

Gene Name (Synonyms) : 
HOM6 YJR139C J2132  

Species :  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MSTKVVNVAVIGAGVVGSAFLDQLLAMKSTITYNLVLLAEAERSLISKDFSPLNVGSDWKAALAASTTKT...
Predicted Secondary Structure CCCEEEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
237PhosphoserineVEVESPTSF
HHHHCCCCC
38.36SysPTM
Link
237Phosphoserine.VEVESPTSF
HHHHCCCCC
38.36UniProtKB
Link
239PhosphothreonineVESPTSFPV
HHCCCCCCC
52.89SysPTM
Link
239Phosphothreonine.VESPTSFPV
HHCCCCCCC
52.89UniProtKB
Link
344PhosphothreonineGAAVTAAGV
CCCCHHHHH
13.18SysPTM
Link
344Phosphothreonine.GAAVTAAGV
CCCCHHHHH
13.18UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases.";
Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.;
Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-237 AND THR-239, ANDMASS SPECTROMETRY.
"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-237 AND THR-344, ANDMASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures