Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Dihydropteridine reductase  

UniProtKB / Swiss-Prot ID :  DHPR_HUMAN

Gene Name (Synonyms) : 
QDPR, DHPR  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  The product of this enzyme, tetrahydrobiopterin (BH-4), is an essential cofactor for phenylalanine, tyrosine, and tryptophan hydroxylases. 

Protein Sequence MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAE...
Predicted Secondary Structure CCCCCCCCCCEEEEEECCCCCHHHHHHHHHHCCCEEEEEEEEEECCCCCCEEEEEECHHHHHHHHHHHHH...
Protein Variant
LocationDescription
14L -> P (in HPABH4C; severe). VAR_008121
17G -> R (in HPABH4C; severe). VAR_021767
17G -> V (in HPABH4C; severe). VAR_008122
18G -> D (in HPABH4C; severe). VAR_021768
23G -> D (in HPABH4C; severe). VAR_006960
36W -> R (in HPABH4C). VAR_006961
51S -> T. VAR_013027
66Q -> R (in HPABH4C; severe). VAR_021769
74L -> P (in HPABH4C). VAR_006962
108W -> G (in HPABH4C). VAR_006963
123T -> TT (in HPABH4C). VAR_006964
145P -> L (in HPABH4C). VAR_006965
149G -> R (in HPABH4C). VAR_021770
150Y -> C (in HPABH4C; mild). VAR_006966
151G -> S (in HPABH4C; mild). VAR_006967
158H -> Y (in HPABH4C; severe). VAR_006968
170G -> S (in HPABH4C). VAR_006969
212F -> C (in HPABH4C; mild). VAR_006970
218G -> GITG (in HPABH4C; mild). VAR_006971
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAAAA
---CCCCCC
13.05UniProtKB
Link-
133PhosphothreonineGGLLTLAGA
CCEEEEECC
21.43HPRD
Link
133PhosphothreonineGGLLTLAGA
CCEEEEECC
21.43Phosphositeplus
Link
223Phosphoserine (CaM-KII_group)KNRPSSGSL
CCCCCCCCE
44.06PhosphoELM
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
DHPR_HUMANyeast 2-hybridHPRD:02025HPRD11461190
IGF1B_HUMANENSP00000281243STRING
RYR1_HUMANENSP00000281243STRING
- top -

Disease Reference
Kegg disease
OMIM disease
261630Hyperphenylalaninemia, BH4-deficient, C (HPABH4C)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures