Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial  

UniProtKB / Swiss-Prot ID :  DHSA_CHICK

Gene Name (Synonyms) : 
SDHA  

Species :  Gallus gallus (Chicken). 

Subcellular Localization :  Mitochondrion inner membrane; Peripheral membrane protein; Matrix side. 

Protein Function :  Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). 

Protein Sequence MAAVVAASRSLAKCWLRPAVRAWPAACQTHARNFHFTVDGKKNASTKVSDSISTQYPVVDHEFDAVVVGA...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
100Tele-8alpha-FAD histidine.PTRSHTVAA
22.52UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures