Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Sorbitol dehydrogenase  

UniProtKB / Swiss-Prot ID :  DHSO_PIG

Gene Name (Synonyms) : 
SORD  

Species :  Sus scrofa (Pig). 

Subcellular Localization :  Mitochondrion membrane; Peripheral membrane protein. Cell projection, cilium, flagellum. Note=Associated with mitochondria of the midpiece and near the plasma membrane in the principal piece of the flagellum. Also found in the epididymosome, secreted by  

Protein Function :  Converts sorbitol to fructose. Part of the polyol pathway that plays an important role in sperm physiology. May play a role in the sperm motility by providing an energetic source for sperm (By similarity). 

Protein Sequence MAAAKPENLSLVVHGPGDLRLENYPIPEPGPNXVLLKMHSVGICGSDVHYWQHGRIGNFVVKKPMVLGHE...
Predicted Secondary Structure CCCCCCCCEEEEEECCCEEEEEEEECCCCCCCEEEEEEEEEEECCHHEEEECCCCCCCCCCCCCEECCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures