Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  DnaJ homolog subfamily C member 11  

UniProtKB / Swiss-Prot ID :  DJC11_HUMAN

Gene Name (Synonyms) : 
DNAJC11  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MATALSEEELDNEDYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLS...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
267V -> M (in dbSNP:rs12137794). VAR_027078
290T -> A (in dbSNP:rs200454). VAR_027079
290T -> S (in dbSNP:rs200454). VAR_055703
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
31Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SEELKAAYR
33.96Phosphositeplus
Link-
83Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DIYGKRGLE
26.73Phosphositeplus
Link-
126Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RTNPKGTIS
71.41Phosphositeplus
Link-
264Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RNLDKNTVG
58.65Phosphositeplus
Link-
409Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RLIIKPYLR
22.18Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures