Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Deoxyribonuclease-1  

UniProtKB / Swiss-Prot ID :  DNAS1_BOVIN

Gene Name (Synonyms) : 
DNASE1, DNL1  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Secreted. Nucleus envelope. Note=Secretory protein, stored in zymogen granules and found in the nuclear envelope. 

Protein Function :  Among other functions, seems to be involved in cell death by apoptosis. Binds specifically to G-actin and blocks actin polymerization (By similarity). 

Protein Sequence MRGTRLMGLLLALAGLLQLGLSLKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAV...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHHHHEEEEHHHHHHCHHHHCCHHHHHHHHHHHHHCCEEEEEEEECCCCCHH...
Protein Variant
LocationDescription
143H -> P (in allele C/D).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
40N-linked (GlcNAc...).TKMSNATLA
HHHCCHHHH
33.18UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures