Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Dipeptidase 1  

UniProtKB / Swiss-Prot ID :  DPEP1_HUMAN

Gene Name (Synonyms) : 
DPEP1, MDP, RDP  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Apical cell membrane; Lipid-anchor, GPI- anchor. Cell projection, microvillus membrane; Lipid-anchor, GPI- anchor. Note=Brush border membrane. 

Protein Function :  Hydrolyzes a wide range of dipeptides. Implicated in the renal metabolism of glutathione and its conjugates. Converts leukotriene D4 to leukotriene E4; it may play an important role in the regulation of leukotriene activity. 

Protein Sequence MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPK...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCHHH...
Protein Variant
LocationDescription
246R -> H (in a colorectal cancer sample;somatic mutation).
351E -> K (in dbSNP:rs1126464). VAR_061375
351E -> Q (in dbSNP:rs1126464). VAR_061376
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
57N-linked (GlcNAc...).DERANLTTL
CCCHHHHHH
44.11UniProtKB
Link
279N-linked (GlcNAc...).TNKANLSQV
CCCCCHHHH
41.66UniProtKB
Link
332N-linked (GlcNAc...).LLRRNWTEA
HHHCCCCHH
43.52UniProtKB
Link
385GPI-anchor amidated serineYGYSSGASS
CCCCCCCCH
29.87HPRD
Link-
385GPI-anchor amidated serine.YGYSSGASS
CCCCCCCCH
29.87UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
K1279_HUMANphysical interactionMINT-67539MINT16189514
K1279_HUMANphysical interaction
physical interaction
EBI-757390
EBI-760476
intact16189514
16189514
DPEP1_HUMANin vitroHPRD:01563HPRD2137335
K1279_HUMANyeast 2-hybridHPRD:01563HPRD16189514
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
Kegg drug
D02194 Cilastatin sodium (JP16/USP); CS
D07698 Cilastatin (INN)
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
GPI-anchor
ReferencePubMed
"Identification of membrane anchoring site of human renal dipeptidaseand construction and expression of a cDNA for its secretory form.";
Adachi H., Katayama T., Inuzuka C., Oikawa S., Tsujimoto M.,Nakazato H.;
J. Biol. Chem. 265:15341-15345(1990).
Cited for: GPI-ANCHOR AT SER-385.
N-linked Glycosylation
ReferencePubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-57 AND ASN-279, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures