Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial  

UniProtKB / Swiss-Prot ID :  DUT_HUMAN

Gene Name (Synonyms) : 
DUT  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Isoform 2: Nucleus. Isoform 3: Mitochondrion. 

Protein Function :  This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA. 

Protein Sequence MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGA...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCHHHCCCCCCC...
Protein Variant
LocationDescription
100P -> S (in dbSNP:rs28381104). VAR_022314
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
88PhosphoserineKAGGSPAPG
CCCCCCCCC
19.57HPRD
Link
88PhosphoserineKAGGSPAPG
CCCCCCCCC
19.57Phosphositeplus
Link
99PhosphoserineTPAISPSKR
CCCCCCCCE
25.81HPRD
Link
99PhosphoserineTPAISPSKR
CCCCCCCCE
25.81PhosphoELM
Link
99PhosphoserineTPAISPSKR
CCCCCCCCE
25.81Phosphositeplus
Link
99PhosphoserineTPAISPSKR
CCCCCCCCE
25.81SysPTM
Link
99Phosphoserine (CDK1)TPAISPSKR
CCCCCCCCE
25.81HPRD
Link
151Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PPMEKAVVK
CCCCEEEEE
39.98Phosphositeplus
Link-
179Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLAAKHFID
CCCCCCCEE
33.18Phosphositeplus
Link-
179N6-acetyllysineGLAAKHFID
CCCCCCCEE
33.18HPRD
Link-
179N6-acetyllysineGLAAKHFID
CCCCCCCEE
33.18Phosphositeplus
Link-
179N6-acetyllysine.GLAAKHFID
CCCCCCCEE
33.18UniProtKB
Link-
239PhosphothreonineALDDTERGS
CCCCCCCCC
27.52HPRD
Link-
239PhosphothreonineALDDTERGS
CCCCCCCCC
27.52PhosphoELM
Link-
239PhosphothreonineALDDTERGS
CCCCCCCCC
27.52Phosphositeplus
Link-
243PhosphoserineTERGSGGFG
CCCCCCCCC
41.80HPRD
Link-
248PhosphoserineGGFGSTGKN
CCCCCCCCC
31.55HPRD
Link-
248PhosphoserineGGFGSTGKN
CCCCCCCCC
31.55PhosphoELM
Link-
249PhosphothreonineGFGSTGKN
CCCCCCCC
53.18HPRD
Link-
251Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GSTGKN
CCCCCC
60.62Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
Q8IZ75_HUMANphysical interactionMINT-68046MINT16189514
SPAT2_HUMANphysical interactionMINT-66521MINT16189514
SPAT2_HUMANphysical interactionEBI-754048
intact16189514
Q8IZ75_HUMANphysical interactionEBI-759076
intact16189514
SPAT2_HUMANyeast 2-hybridHPRD:03165HPRD16189514
PPARA_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:03165HPRD8910358
DUT_HUMANin vitroHPRD:03165HPRD8805593
PPARD_HUMANin vitro
in vivo
HPRD:03165HPRD8910358
NDK3_HUMANENSP00000249783STRING
NDKM_HUMANENSP00000249783STRING
UNG_HUMANENSP00000249783STRING
NDK5_HUMANENSP00000249783STRING
KITM_HUMANENSP00000249783STRING
KITH_HUMANENSP00000249783STRING
NDK6_HUMANENSP00000249783STRING
TYSY_HUMANENSP00000249783STRING
DCTD_HUMANENSP00000249783STRING
NDKA_HUMANENSP00000249783STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-179, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures