Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glucan endo-1,3-beta-glucosidase 14  

UniProtKB / Swiss-Prot ID :  E1314_ARATH

Gene Name (Synonyms) : 
At2g27500 F10A12.18  

Species :  Arabidopsis thaliana (Mouse-ear cress). 

Subcellular Localization :  Isoform 1: Cell membrane; Lipid-anchor, GPI- anchor; Extracellular side (Probable). Secreted, cell wall (Potential). Isoform 2: Secreted, cell wall (Potential). Isoform 3: Cytoplasm (Potential). 

Protein Function :   

Protein Sequence MATHSLSFFFRVLLLLFLTLSERIKGQGVGINYGQIANNLPSPARVAVLLRSLNITRVKLYDADPNVLFS...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures