Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Chromatin modification-related protein MEAF6  

UniProtKB / Swiss-Prot ID :  EAF6_MOUSE

Gene Name (Synonyms) : 
Meaf6  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Nucleus, nucleolus (By similarity). 

Protein Function :  Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity (By similarity). 

Protein Sequence MAMHNKTAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKN...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
90PhosphoserineERLFSKSSV
35.90Phosphositeplus
Link-
92PhosphoserineLFSKSSVTS
28.92Phosphositeplus
Link-
93PhosphoserineFSKSSVTSA
32.90Phosphositeplus
Link-
96PhosphoserineSSVTSAAAV
17.47Phosphositeplus
Link-
118PhosphoserineREPGSGTES
53.94Phosphositeplus
Link-
120PhosphothreoninePGSGTESDT
33.73Phosphositeplus
Link-
122PhosphoserineSGTESDTSP
46.13Phosphositeplus
Link-
124PhosphothreonineTESDTSPDF
51.98Phosphositeplus
Link-
125PhosphoserineESDTSPDFH
27.71Phosphositeplus
Link-
146PhosphoserineDLDGSVQGV
15.78Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures