Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cell wall protein ecm33  

UniProtKB / Swiss-Prot ID :  ECM33_SCHPO

Gene Name (Synonyms) : 
ecm33 SPAC1705.03c, SPAC1F2.01, SPAC23H4.19  

Species :  Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor (By similarity). Secreted, cell wall. 

Protein Function :  Involved in the negative feedback regulation of pmk1 cell integrity signaling and is linked to cellular calcium signaling. 

Transmembrane Topology (topPTM) : ECM33_SCHPO 

Protein Sequence MLFKSFALTLLFAAARVQAASNCSSGPYNISAQGTLDELNSCTVLNGDLYISDAGNSGITTLTVNGIESV...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures