Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Eosinophil cationic protein  

UniProtKB / Swiss-Prot ID :  ECP_HUMAN

Gene Name (Synonyms) : 
RNASE3, ECP, RNS3  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. Note=Located in the matrix of eosinophil large specific granule, which are released following activation by an immune stimulus. 

Protein Function :  Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. Promotes E. coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content. 

Protein Sequence MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTF...
Predicted Secondary Structure CCCCHHHHHHEEEEEEECCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCEEEEE...
Protein Variant
LocationDescription
72R -> C. VAR_014109
124T -> R (in dbSNP:rs2073342). VAR_013149
130G -> R (in dbSNP:rs12147890). VAR_029017
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
60Nitrated tyrosine.AINNYRWRC
CCCCCCCCC
13.68UniProtKB
Link
134PhosphotyrosineGRRFYVVAC
CCEEEEEEE
7.69Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Nitration
ReferencePubMed
"Post-translational tyrosine nitration of eosinophil granule toxinsmediated by eosinophil peroxidase.";
Ulrich M., Petre A., Youhnovski N., Proemm F., Schirle M., Schumm M.,Pero R.S., Doyle A., Checkel J., Kita H., Thiyagarajan N.,Acharya K.R., Schmid-Grendelmeier P., Simon H.-U., Schwarz H.,Tsutsui M., Shimokawa H., Bellon G., Lee J.J., Przybylski M.,Doering G.;
J. Biol. Chem. 283:28629-28640(2008).
Cited for: NITRATION AT TYR-60.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures