Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Elongation factor 1-beta  

UniProtKB / Swiss-Prot ID :  EF1B_ARTSA

Gene Name (Synonyms) :  -
 

Species :  Artemia salina (Brine shrimp). 

Subcellular Localization :   

Protein Function :  EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP. 

Protein Sequence MANIDLKAEKGQEQLNELLANKSYLQGYEPSQEDVAAFNQLNKAPSDKFPYLLRWYKHISSFSDAEKKGF...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHHHHCCCEECCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MANIDL
---CCCCCC
22.99UniProtKB
Link-
90Phosphoserine (CK2_group)DLFGSDEED
CCCCCCCCC
34.22PhosphoELM
Link-
90Phosphoserine; by CK2.DLFGSDEED
CCCCCCCCC
34.22UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures