Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ephrin-4  

UniProtKB / Swiss-Prot ID :  EFN4_CAEEL

Gene Name (Synonyms) : 
efn-4, mab-26 F56A11.3  

Species :  Caenorhabditis elegans. 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor (Potential). 

Protein Function :  Regulates the formation or stabilization of cell-cell contacts at several stages of epithelial morphogenesis. In early embryonic development, involved in ventral closure of the epidermis. During male tail morphogenesis, regulates precursor cell sorting together with mab-20 and allows the formation of distinct sensory rays. 

Protein Sequence MKQFFEFLITTFLLLGLAAADEHIVYWNSTNSLFRNRQPTIEVRMGDVVRFVCPDNEEGRNDGEYLIVYE...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCCEECCCCEEEEEECCEEEEECCCCCCCCCCCCEEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures