Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Translation initiation factor eIF-2B subunit epsilon  

UniProtKB / Swiss-Prot ID :  EI2BE_RAT

Gene Name (Synonyms) : 
Eif2b5, Eif2be  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :   

Protein Function :  Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. 

Protein Sequence MAATAAVPSAVGGRANKRGGGSGGGGTQGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVAL...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEECCCEEH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
461PhosphoserineDGQFSDDSG
CCEECCCCC
32.40Phosphositeplus
Link-
464PhosphoserineFSDDSGADQ
ECCCCCCCE
40.65Phosphositeplus
Link-
535PhosphoserineEELDSRAGS
HHCCCCCCC
36.33Phosphositeplus
Link-
535Phosphoserine (GSK-3_group)EELDSRAGS
HHCCCCCCC
36.33PhosphoELM
Link-
539PhosphoserineSRAGSPQLD
CCCCCCCCH
14.42PhosphoELM
Link-
539PhosphoserineSRAGSPQLD
CCCCCCCCH
14.42Phosphositeplus
Link-
539PhosphoserineSRAGSPQLD
CCCCCCCCH
14.42SysPTM
Link-
539Phosphoserine.SRAGSPQLD
CCCCCCCCH
14.42UniProtKB
Link-
712PhosphoserineAEEESSDDD
HCCCCCCCC
42.20Phosphositeplus
Link-
712Phosphoserine (CK2_group)AEEESSDDD
HCCCCCCCC
42.20PhosphoELM
Link-
713PhosphoserineEEESSDDD
CCCCCCCC
48.62Phosphositeplus
Link-
713Phosphoserine (CK2_group)EEESSDDD
CCCCCCCC
48.62PhosphoELM
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Phosphoproteomic analysis of rat liver by high capacity IMAC and LC-MS/MS.";
Moser K., White F.M.;
J. Proteome Res. 5:98-104(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-539, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures