Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Gamma-enolase  

UniProtKB / Swiss-Prot ID :  ENOG_HUMAN

Gene Name (Synonyms) : 
ENO2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). Cell membrane (By similarity). Note=Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form (By similarity). 

Protein Function :  Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival (By similarity). 

Protein Sequence MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN...
Predicted Secondary Structure CEEEEEEEEEEEECCCCCEEEEEEEECCCEEEEECCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHH...
Protein Variant
LocationDescription
264P -> A. VAR_002354
395T -> A. VAR_002355
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
25PhosphotyrosineEVDLYTAKG
EEEEEECCC
10.53HPRD
Link
26PhosphothreonineVDLYTAKGL
EEEEECCCE
29.23HPRD
Link
26PhosphothreonineVDLYTAKGL
EEEEECCCE
29.23Phosphositeplus
Link
34noneLFRAAVPSG
EEEEECCCC
14.97HPRD
Link
37PhosphoserineAAVPSGAST
EECCCCCCC
40.15Phosphositeplus
Link
40PhosphoserinePSGASTGIY
CCCCCCCCC
30.60Phosphositeplus
Link
44PhosphotyrosineSTGIYEALE
CCCCCEEEE
9.11HPRD
Link
44PhosphotyrosineSTGIYEALE
CCCCCEEEE
9.11PhosphoELM
Link
44PhosphotyrosineSTGIYEALE
CCCCCEEEE
9.11Phosphositeplus
Link
44PhosphotyrosineSTGIYEALE
CCCCCEEEE
9.11SysPTM
Link
44Phosphotyrosine.STGIYEALE
CCCCCEEEE
9.11UniProtKB
Link
193N6-acetyllysineYHTLKGVIK
HHHHHHHHH
52.89Phosphositeplus
Link
197N6-acetyllysineKGVIKDKYG
HHHHHHHHC
45.84Phosphositeplus
Link
263PhosphoserineLDFKSPTDP
EECCCCCCC
32.78Phosphositeplus
Link
265PhosphothreonineFKSPTDPSR
CCCCCCCCC
68.58HPRD
Link
265PhosphothreonineFKSPTDPSR
CCCCCCCCC
68.58Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
SPN1_HUMANphysical interactionMINT-63267MINT16169070
SIA4B_HUMANphysical interactionMINT-63434MINT16169070
Q6FHW0_HUMANphysical interactionMINT-63435MINT16169070
SIGIR_HUMANphysical interactionMINT-63437MINT16169070
Q9BQP1_HUMANphysical interactionMINT-63441MINT16169070
IL17B_HUMANphysical interactionMINT-63443MINT16169070
NAT9_HUMANphysical interactionEBI-729939
intact16169070
HXK1_HUMANphysical interactionEBI-729942
intact16169070
TBA4A_HUMANphysical interactionEBI-729945
intact16169070
ANX11_HUMANphysical interactionEBI-731812
intact16169070
ENSA_HUMANphysical interactionEBI-731815
intact16169070
HABP4_HUMANphysical interactionEBI-731818
intact16169070
MAP4_HUMANphysical interactionEBI-731821
intact16169070
CF047_HUMANphysical interactionEBI-734424
intact16169070
HSF1_HUMANphysical interactionEBI-734427
intact16169070
IL17B_HUMANphysical interactionEBI-734430
intact16169070
NDUS7_HUMANphysical interactionEBI-734433
intact16169070
SIGIR_HUMANphysical interactionEBI-734439
intact16169070
UBE2C_HUMANphysical interactionEBI-734442
intact16169070
HXK1_HUMANyeast 2-hybridHPRD:00573HPRD16169070
TBA4A_HUMANyeast 2-hybridHPRD:00573HPRD16169070
HSF1_HUMANyeast 2-hybridHPRD:00573HPRD16169070
MAP4_HUMANyeast 2-hybridHPRD:00573HPRD16169070
NDUS7_HUMANyeast 2-hybridHPRD:00573HPRD16169070
IL17B_HUMANyeast 2-hybridHPRD:00573HPRD16169070
UBE2C_HUMANyeast 2-hybridHPRD:00573HPRD16169070
SIA4B_HUMANyeast 2-hybridHPRD:00573HPRD16169070
SPN1_HUMANyeast 2-hybridHPRD:00573HPRD16169070
ENSA_HUMANyeast 2-hybridHPRD:00573HPRD16169070
SIGIR_HUMANyeast 2-hybridHPRD:00573HPRD16169070
CP045_HUMANyeast 2-hybridHPRD:00573HPRD16169070
CF047_HUMANyeast 2-hybridHPRD:00573HPRD16169070
HABP4_HUMANyeast 2-hybridHPRD:00573HPRD16169070
TPIS_HUMANENSP00000229277STRING
KPYR_HUMANENSP00000229277STRING
PGAM2_HUMANENSP00000229277STRING
KPYM_HUMANENSP00000229277STRING
KPYM_HUMANENSP00000229277STRING
- top -

Disease Reference
Kegg disease
H00013 Small cell lung cancer
H00043 Neuroblastoma
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Time-resolved mass spectrometry of tyrosine phosphorylation sites inthe epidermal growth factor receptor signaling network reveals dynamicmodules.";
Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J.,Lauffenburger D.A., White F.M.;
Mol. Cell. Proteomics 4:1240-1250(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-44, AND MASSSPECTROMETRY.
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-44, AND MASSSPECTROMETRY.
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-44, AND MASSSPECTROMETRY.
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells.";
Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.;
J. Proteome Res. 8:3852-3861(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-44, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures