Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Eukaryotic peptide chain release factor subunit 1  

UniProtKB / Swiss-Prot ID :  ERF1_MOUSE

Gene Name (Synonyms) : 
Etf1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA (By similarity). Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense- mediated decay (NMD) of mRNAs containing premature stop codons (By similarity). 

Protein Sequence MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLS...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
127S-nitrosocysteineSLYLCDNKF
CEEEECCCH
3.24dbSNO
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures