Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Exocyst complex component 5  

UniProtKB / Swiss-Prot ID :  EXOC5_HUMAN

Gene Name (Synonyms) : 
EXOC5, SEC10, SEC10L1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane. 

Protein Sequence MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERIQRKVEKLEQQ...
Predicted Secondary Structure CCCCHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH...
Protein Variant
LocationDescription
10E -> D (in dbSNP:rs35132458). VAR_048957
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
3Phosphothreonine--MATTAEL
--CCCCHHH
25.82HPRD
Link-
3Phosphothreonine--MATTAEL
--CCCCHHH
25.82Phosphositeplus
Link-
4Phosphothreonine-MATTAELF
-CCCCHHHH
14.48HPRD
Link-
122PhosphothreonineEGVNTPRQR
HHHHHHHHH
19.90HPRD
Link-
122PhosphothreonineEGVNTPRQR
HHHHHHHHH
19.90Phosphositeplus
Link-
122Phosphothreonine.EGVNTPRQR
HHHHHHHHH
19.90UniProtKB
Link-
328PhosphothreonineFNLGTDKQT
HCCCCCCCH
43.09Phosphositeplus
Link-
561N6-acetyllysineKTDFKPEDE
CCCCCCCCC
50.75HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
KPCG_HUMANphysical interactionMINT-2868645MINT16713569
RALA_HUMANin vitroHPRD:07258HPRD11406615
ARF6_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:07258HPRD14662749
EXOC2_HUMANENSP00000342100STRING
EXOC8_HUMANENSP00000342100STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle.";
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.;
Mol. Cell 31:438-448(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-122, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures