Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fructose-1,6-bisphosphatase 1  

UniProtKB / Swiss-Prot ID :  F16P1_HUMAN

Gene Name (Synonyms) : 
FBP1, FBP  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQ...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCCHH...
Protein Variant
LocationDescription
164G -> S (in FBPD). VAR_002380
177A -> D (in FBPD). VAR_002381
194F -> S (in FBPD). VAR_038812
218R -> K (in dbSNP:rs1769259). VAR_022212
233F -> I (in dbSNP:rs2297085). VAR_022213
255R -> L (in dbSNP:rs28369761). VAR_022214
284P -> R (in FBPD). VAR_038813
325V -> A. VAR_002382
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
216PhosphotyrosineLNEGYARDF
CCCCCCCCC
7.71Phosphositeplus
Link
259PhosphotyrosineRTLVYGGIF
HHHHHCCEE
16.85Phosphositeplus
Link
265PhosphotyrosineGIFLYPANK
CEEECCCCC
6.91Phosphositeplus
Link
330N6-acetyllysineLEFLKVYEK
HHHHHHHHH
48.36Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
F16P1_HUMANphysical interaction
physical interaction
EBI-729969
EBI-760411
intact16169070
16189514
CN135_HUMANphysical interactionEBI-755350
intact16189514
FXR2_HUMANphysical interactionEBI-755707
intact16189514
RN183_HUMANphysical interactionEBI-759043
intact16189514
LNX1_HUMANphysical interactionEBI-759745
intact16189514
ACTN1_HUMANin vivoHPRD:01973HPRD12507293
F16P1_HUMANin vitro
yeast 2-hybrid
HPRD:01973HPRD2164670
16169070
16189514
FXR2_HUMANyeast 2-hybridHPRD:01973HPRD16189514
HSP7C_HUMANyeast 2-hybridHPRD:01973HPRD16169070
RN183_HUMANyeast 2-hybridHPRD:01973HPRD16189514
ASCC2_HUMANyeast 2-hybridHPRD:01973HPRD16169070
CN135_HUMANyeast 2-hybridHPRD:01973HPRD16189514
LNX1_HUMANyeast 2-hybridHPRD:01973HPRD16189514
ATPK_HUMANyeast 2-hybridHPRD:01973HPRD16169070
- top -

Disease Reference
Kegg disease
OMIM disease
229700Fructose-1,6-bisphosphatase deficiency (FBPD)
Drug Reference
DrugBank
DB00131Adenosine monophosphate
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures