Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Coagulation factor VII  

UniProtKB / Swiss-Prot ID :  FA7_HUMAN

Gene Name (Synonyms) : 
F7  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. 

Protein Function :  Initiates the extrinsic pathway of blood coagulation. Serine protease that circulates in the blood in a zymogen form. Factor VII is converted to factor VIIa by factor Xa, factor XIIa, factor IXa, or thrombin by minor proteolysis. In the presence of tissue factor and calcium ions, factor VIIa then converts factor X to factor Xa by limited proteolysis. Factor VIIa will also convert factor IX to factor IXa in the presence of tissue factor and calcium. 

Protein Sequence MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRRANAFLEELRP...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHHCEEEEECCEEECCCCCCCCCCCCCCCHHHHHCEEECCCCCHHHHHHCC...
Protein Variant
LocationDescription
13L -> P (in FA7D; Morioka). VAR_014391
59R -> RR (in FA7D). VAR_065369
64F -> L (in FA7D). VAR_015135
73L -> Q (in FA7D; dbSNP:rs45572939). VAR_014405
79E -> Q (in FA7D). VAR_014406
82C -> F (in FA7D). VAR_065370
82C -> R (in FA7D). VAR_065371
84Missing (in FA7D). VAR_065372
85E -> K (in FA7D). VAR_065373
88R -> G (in FA7D). VAR_065374
88R -> P (in FA7D). VAR_065375
117N -> D (in FA7D; exhibits no procoagulantactivity and is unable to bind tissue
120S -> P (in FA7D). VAR_015136
121C -> F (in FA7D). VAR_014407
125L -> P (in FA7D). VAR_014408
128Y -> C (in FA7D). VAR_014409
138G -> D (in FA7D). VAR_065377
139R -> K (in FA7D). VAR_006497
139R -> Q (in FA7D; Charlotte). VAR_006498
139R -> W (in FA7D). VAR_006499
151C -> S (in FA7D). VAR_014410
154E -> K (in FA7D). VAR_015137
156G -> S (in FA7D). VAR_065378
157G -> C (in FA7D). VAR_006501
157G -> S (in FA7D). VAR_006500
157G -> V (in FA7D). VAR_014411
160Q -> R (in FA7D). VAR_006502
171S -> F (in FA7D). VAR_065379
177G -> R (in FA7D). VAR_065380
181L -> P (in FA7D). VAR_065381
183D -> N (in FA7D). VAR_065382
186S -> F (in FA7D). VAR_065383
189P -> S (in FA7D). VAR_065384
194P -> L (in FA7D). VAR_065385
194P -> T (in FA7D; Malta-I). VAR_006503
195C -> R (in FA7D). VAR_014412
197K -> E (in FA7D). VAR_006504
198I -> T (in FA7D). VAR_065386
212R -> Q (in FA7D; Charlotte). VAR_006505
216G -> D (in FA7D). VAR_015138
238C -> Y (in FA7D). VAR_006506
240G -> R (in FA7D). VAR_065387
241T -> N (in FA7D). VAR_014413
250S -> F (in FA7D). VAR_065388
251A -> P (in FA7D). VAR_065389
251A -> T (in FA7D). VAR_065390
254C -> R (in FA7D). VAR_065391
254C -> Y (in FA7D). VAR_015139
264L -> P (in FA7D). VAR_065392
266A -> T (in FA7D). VAR_015140
272D -> N (in FA7D). VAR_065393
277D -> N (in FA7D). VAR_065394
283R -> W (in FA7D). VAR_006507
295V -> D (in dbSNP:rs6045). VAR_013936
298T -> I (in FA7D). VAR_065395
301H -> Q (in FA7D). VAR_065396
302D -> H (in FA7D). VAR_014414
302D -> N (in FA7D). VAR_014415
304A -> T (in FA7D). VAR_014416
304A -> V (in FA7D; Malta-II). VAR_006508
307R -> C (in FA7D). VAR_014417
307R -> H (in FA7D; Mie). VAR_006509
312V -> M (in FA7D). VAR_015141
314L -> V (in FA7D). VAR_065397
321L -> F (in FA7D). VAR_065398
323L -> R (in FA7D). VAR_065399
325E -> K (in FA7D). VAR_006510
326R -> Q (in FA7D). VAR_065400
332T -> M (in FA7D). VAR_014418
337R -> C (in FA7D). VAR_065401
341V -> F (in FA7D). VAR_015142
343G -> S (in FA7D). VAR_065402
344W -> R (in FA7D). VAR_065403
345G -> S (in FA7D). VAR_065404
350R -> C (in FA7D). VAR_065405
352A -> T (in dbSNP:rs3093267). VAR_013122
354A -> V (in FA7D; dbSNP:rs36209567). VAR_006511
358M -> I (in FA7D). VAR_006512
358M -> V (in FA7D). VAR_006513
360L -> P (in FA7D). VAR_065406
363P -> H (in FA7D). VAR_065407
363P -> R (in FA7D). VAR_015143
364R -> Q (in FA7D; Harrow/Padua). VAR_006514
364R -> W (in FA7D). VAR_065408
367T -> S. VAR_018671
370C -> F (in FA7D). VAR_006515
375R -> W (in FA7D). VAR_065409
384T -> M (in FA7D). VAR_065410
387M -> T (in FA7D). VAR_065411
387M -> V (in FA7D). VAR_065412
388F -> S (in FA7D; reduces tissue factorbinding; impairs activation by factor Xa;
389C -> G (in FA7D). VAR_014392
391G -> C (in FA7D). VAR_065414
391G -> S (in FA7D). VAR_014419
398D -> E (in FA7D). VAR_065415
401K -> E (in FA7D). VAR_065416
402G -> E (in FA7D). VAR_006517
402G -> R (in FA7D). VAR_006516
403D -> H (in FA7D). VAR_015144
404S -> N (in FA7D). VAR_065417
408H -> Q (in FA7D). VAR_065418
408H -> R (in FA7D). VAR_065419
413R -> G (in FA7D). VAR_065420
413R -> Q (may be associated with decreasedsusceptibility to myocardial infarction;
414G -> C (in FA7D; results in severelyimpaired protein secretion).
419T -> M (in FA7D). VAR_006519
422V -> F (in FA7D). VAR_065422
425G -> A (in FA7D). VAR_065423
425G -> C (in FA7D). VAR_065424
429A -> T (in FA7D). VAR_065425
432G -> D (in FA7D). VAR_065426
435G -> E (in FA7D). VAR_014420
437Y -> F (in FA7D). VAR_065427
445E -> K (in dbSNP:rs3093248). VAR_013123
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
664-carboxyglutamate.NAFLEELRP
CHHHHHHCC
48.83UniProtKB
Link-
674-carboxyglutamate.AFLEELRPG
HHHHHHCCC
52.83UniProtKB
Link-
744-carboxyglutamate.PGSLERECK
CCCCEEEEE
48.40UniProtKB
Link-
764-carboxyglutamate.SLERECKEE
CCEEEEECC
40.33UniProtKB
Link-
794-carboxyglutamate.RECKEEQCS
EEEECCCCC
66.03UniProtKB
Link-
804-carboxyglutamate.ECKEEQCSF
EEECCCCCC
42.24UniProtKB
Link-
854-carboxyglutamate.QCSFEEARE
CCCCCCCCC
34.16UniProtKB
Link-
864-carboxyglutamate.CSFEEAREI
CCCCCCCCE
51.52UniProtKB
Link-
894-carboxyglutamate.EEAREIFKD
CCCCCEECC
60.88UniProtKB
Link-
954-carboxyglutamateFKDAERTKL
ECCCCCCCC
71.64HPRD
Link-
954-carboxyglutamate.FKDAERTKL
ECCCCCCCC
71.64UniProtKB
Link-
112O-linked (Fuc)DQCASSPCQ
CCCCCCCCC
42.30OGlycBase
Link
112O-linked (Glc...)./FTId=CAR_000007.DQCASSPCQ
CCCCCCCCC
42.30UniProtKB
Link
120O-linked (Fuc).QNGGSCKDQ
CCCCEEECC
21.28UniProtKB
Link
120O-linked (Xyl...) (glycosaminoglycan)QNGGSCKDQ
CCCCEEECC
21.28OGlycBase
Link
123(3R)-3-hydroxyaspartate.GSCKDQLQS
CEEECCCCC
59.77UniProtKB
Link
205N-linked (Glc...)LEKRNASKP
CCCEECCCC
60.68HPRD
Link-
205N-linked (GlcNAc...)LEKRNASKP
CCCEECCCC
60.68OGlycBase
Link-
205N-linked (GlcNAc...).LEKRNASKP
CCCEECCCC
60.68UniProtKB
Link-
212noneKPQGRIVGG
CCCEEEEEC
18.38HPRD
Link-
382N-linked (Glc...)GDSPNITEY
CCCCEECCC
58.74HPRD
Link-
382N-linked (GlcNAc...)GDSPNITEY
CCCCEECCC
58.74OGlycBase
Link-
382N-linked (GlcNAc...).GDSPNITEY
CCCCEECCC
58.74UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NEMO_HUMANphysical interactionMINT-48178MINT14743216
FA7_HUMANphysical interaction
physical interaction
EBI-1040745
EBI-1041491
intact15522303
15664864
TF_HUMANphysical interaction
physical interaction
EBI-1040745
EBI-1041491
intact15522303
15664864
TF_HUMANin vitroHPRD:01965HPRD12787023
9925787
FA7_HUMANin vitroHPRD:01965HPRD8598903
10430872
9925787
10544046
11470437
- top -

Disease Reference
Kegg disease
OMIM disease
227500Factor VII deficiency (FA7D)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Gamma-carboxyglutamic acid
ReferencePubMed
"Characterization of a cDNA coding for human factor VII.";
Hagen F.S., Gray C.L., O'Hara P.J., Grant F.J., Saari G.C.,Woodbury R.G., Hart C.E., Insley M.Y., Kisiel W., Kurachi K.,Davie E.W.;
Proc. Natl. Acad. Sci. U.S.A. 83:2412-2416(1986).
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
N-linked Glycosylation
ReferencePubMed
"Amino acid sequence and posttranslational modifications of humanfactor VIIa from plasma and transfected baby hamster kidney cells.";
Thim L., Bjoern S., Christensen M., Nicolaisen E.M., Lund-Hansen T.,Pedersen A.H., Hedner U.;
Biochemistry 27:7785-7793(1988).
Cited for: PROTEIN SEQUENCE OF 61-466, AND POST-TRANSLATIONAL MODIFICATIONS.
O-linked Glycosylation
ReferencePubMed
"Human plasma and recombinant factor VII. Characterization of O-glycosylations at serine residues 52 and 60 and effects of site-directed mutagenesis of serine 52 to alanine.";
Bjoern S., Foster D.C., Thim L., Wiberg F.C., Christensen M.,Komiyama Y., Pedersen A.H., Kisiel W.;
J. Biol. Chem. 266:11051-11057(1991).
Cited for: GLYCOSYLATION AT SER-112 AND SER-120.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures