Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fatty acid-binding protein, adipocyte  

UniProtKB / Swiss-Prot ID :  FABP4_HUMAN

Gene Name (Synonyms) : 
FABP4  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus. Note=Depending on the nature of the ligand, a conformation change exposes a nuclear localization motif and the protein is transported into the nucleus. Subject to constitutive nuclear export (By similarity). 

Protein Function :  Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus (By similarity). 

Protein Sequence MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQE...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
23E -> D (in a breast cancer sample;somatic mutation).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
20PhosphotyrosineNFDDYMKEV
16.36PhosphoELM
Link
20Phosphotyrosine (INSR)NFDDYMKEV
16.36HPRD
Link
129PhosphotyrosineSTRVYERA
9.08PhosphoELM
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
VIME_HUMANphysical interactionEBI-731860
intact16169070
SYUG_HUMANphysical interactionEBI-1077459
intact17353931
EXT2_HUMANphysical interactionEBI-1083751
intact17353931
OSTF1_HUMANphysical interactionEBI-1079846
intact17353931
LIPS_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:02698HPRD10318917
VIME_HUMANyeast 2-hybridHPRD:02698HPRD16169070
LIPS_HUMANENSP00000256104STRING
INS_HUMANENSP00000256104STRING
INS_HUMANENSP00000256104STRING
FABPL_HUMANENSP00000256104STRING
INSR_HUMANENSP00000256104STRING
FANCB_HUMANENSP00000256104STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures