Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fatty acid-binding protein, adipocyte  

UniProtKB / Swiss-Prot ID :  FABP4_MOUSE

Gene Name (Synonyms) : 
Fabp4, Ap2  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. Nucleus. Note=Depending on the nature of the ligand, a conformation change exposes a nuclear localization motif and the protein is transported into the nucleus. Subject to constitutive nuclear export. 

Protein Function :  Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. 

Protein Sequence MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVE...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
13PhosphoserineWKLVSSENF
42.23Phosphositeplus
Link
20PhosphotyrosineNFDDYMKEV
16.36Phosphositeplus
Link
20Phosphotyrosine (INSR)NFDDYMKEV
16.36PhosphoELM
Link
30PhosphothreonineVGFATRKVA
28.85Phosphositeplus
Link
57PhosphothreonineRSESTFKNT
34.28Phosphositeplus
Link
75PhosphothreonineFDEITADDR
23.22Phosphositeplus
Link
118S-nitrosocysteineLVVECVMKG
2.15dbSNO
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures