Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fatty acid-binding protein, epidermal  

UniProtKB / Swiss-Prot ID :  FABP5_HUMAN

Gene Name (Synonyms) : 
FABP5  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. 

Protein Sequence MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLG...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MATVQQ
---
19.24UniProtKB
Link
17Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LVDSKGFDE
60.16Phosphositeplus
Link
17N6-acetyllysineLVDSKGFDE
60.16HPRD
Link
17N6-acetyllysineLVDSKGFDE
60.16Phosphositeplus
Link
17N6-acetyllysine.LVDSKGFDE
60.16UniProtKB
Link
24Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DEYMKELGV
49.22Phosphositeplus
Link
55N6-acetyllysineNLTIKTEST
40.79HPRD
Link
55N6-acetyllysineNLTIKTEST
40.79Phosphositeplus
Link
61Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ESTLKTTQF
50.00Phosphositeplus
Link
82Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ADGRKTQTV
50.98Phosphositeplus
Link
131PhosphotyrosineCTRIYEKVE
13.35HPRD
Link
131PhosphotyrosineCTRIYEKVE
13.35Phosphositeplus
Link
131Phosphotyrosine.CTRIYEKVE
13.35UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
HNF1A_HUMANphysical interactionEBI-1064754
intact17353931
S10A7_HUMANin vivoHPRD:05524HPRD10331666
12839573
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-17, AND MASS SPECTROMETRY.
"Exploring proteomes and analyzing protein processing by massspectrometric identification of sorted N-terminal peptides.";
Gevaert K., Goethals M., Martens L., Van Damme J., Staes A.,Thomas G.R., Vandekerckhove J.;
Nat. Biotechnol. 21:566-569(2003).
Cited for: PROTEIN SEQUENCE OF 2-10, AND ACETYLATION AT ALA-2.
Phosphorylation
ReferencePubMed
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-131, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures